Scaffold Ga0153971_1051176

Overview

Basic Information

• Taxon OID: 3300012076
• Scaffold ID: Ga0153971_1051176
• Source Dataset Name: Attine ant fungus gardens microbial communities from Georgia, USA - TSGA055 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 737
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: Georgia, George L Smith State Park
• Coordinates
  • Lat. (^o): 32.5453
  • Long. (^o): -82.1226

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093243	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153971_10511762	F093243	AGG	MLLSYIPTEDQDANILTKALTRRKFEYHRGRIGVADNPYLVER