Scaffold Ga0153973_100083

Overview

Basic Information

• Taxon OID: 3300012064
• Scaffold ID: Ga0153973_100083
• Source Dataset Name: Attine ant fungus gardens microbial communities from Georgia, USA - TSGA057 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 16474
• Total Scaffold Genes: 18
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 15 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: Georgia, Yuchi Wildlife Management Area
• Coordinates
  • Lat. (^o): 33.0838
  • Long. (^o): -81.771

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058580	Metagenome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153973_1000837	F058580	GAG	MVFTTELVLAIPDIDREMRVEVDALDYTTGGVLLTKYKDGK*