NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153937_1068856

Scaffold Ga0153937_1068856


Overview

Basic Information
Taxon OID3300012060 Open in IMG/M
Scaffold IDGa0153937_1068856 Open in IMG/M
Source Dataset NameAttine ant fungus gardens microbial communities from New York, USA - TSNY021 MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)645
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: New York, Robert Murphy County Park
CoordinatesLat. (o)40.8926Long. (o)-72.8224Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035581Metagenome171Y

Sequences

Protein IDFamilyRBSSequence
Ga0153937_10688561F035581GGAGMKFVTLRLCKGIEVMLILANYHYVCWGARFSPSQVPTFLLTTALIIGLNYHLKKRIPTLDGLLEVTVTPLHIPLTMECSTR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.