Basic Information | |
---|---|
Taxon OID | 3300012060 Open in IMG/M |
Scaffold ID | Ga0153937_1025420 Open in IMG/M |
Source Dataset Name | Attine ant fungus gardens microbial communities from New York, USA - TSNY021 MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1423 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: New York, Robert Murphy County Park | |||||||
Coordinates | Lat. (o) | 40.8926 | Long. (o) | -72.8224 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F050060 | Metagenome | 145 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0153937_10254201 | F050060 | N/A | QGYDAILVVCNCFSKMAHFIATIEKTSAEGLTKLF* |
⦗Top⦘ |