Scaffold Ga0153967_105609

Overview

Basic Information

• Taxon OID: 3300012055
• Scaffold ID: Ga0153967_105609
• Source Dataset Name: Attine ant fungus gardens microbial communities from Florida, USA - TSFL051 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 806
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: Florida, Paynes
• Coordinates
  • Lat. (^o): 27.6231
  • Long. (^o): -81.8092

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031319	Metagenome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153967_1056092	F031319	N/A	MSMREGEFVNVYVERYWEIFNEIDGNFNEVAIRTFKVGFPSEHGLRKSLTVKHVTSLRQLMDRVDKYKMIEDDQ*