Scaffold Ga0154007_1007754

Overview

Basic Information

• Taxon OID: 3300012054
• Scaffold ID: Ga0154007_1007754
• Source Dataset Name: Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC091 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2207
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: Connecticut, Klassen Lab
• Coordinates
  • Lat. (^o): 41.8102
  • Long. (^o): -72.2564

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006171	Metagenome	379	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0154007_10077542	F006171	GGA	MWYYKQEEDNLNKLARTVLHMLFFIMFCYFQRGRIDGIQEFQSVVLNLENKGRIQDKEIERNRLAHRWFLIDVTMPIIFMLEIVLSHLSSMVKSYFSSLLLMHRQIVSKGDLTRLEHINILLDLSFTRDYRMLLCMIGMMEKMLGFWGANSFFSLLMWRVLGL*