Scaffold Ga0136589_1004207

Overview

Basic Information

• Taxon OID: 3300012033
• Scaffold ID: Ga0136589_1004207
• Source Dataset Name: Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 3 #764
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5540
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (23.08%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Rauer Islands
• Coordinates
  • Lat. (^o): -68.5558
  • Long. (^o): 78.1913

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001506	Metagenome / Metatranscriptome	681	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136589_10042072	F001506	N/A	MNRLSSKKLPSEPRPLKYLTPVSVKTFQIRYEKKLSPIAKLILNSFQKKYIYYAIDDILYSPQLNSKERENLLGILYSPVISLQNNFSIHFFDIWIHEIYIHEISKLNKFLKNDSSNFNQQNYITIKFEYQRRSPSKKPDTLW*