| Basic Information | |
|---|---|
| Taxon OID | 3300012021 Open in IMG/M |
| Scaffold ID | Ga0120192_10006509 Open in IMG/M |
| Source Dataset Name | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Georgia Institute of Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1631 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial → Terrestrial Microbial Communites From A Soil Warming Plot In Okalahoma, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Kessler Farm Field Laboratory (KFFL), Okalahoma | |||||||
| Coordinates | Lat. (o) | 34.975667 | Long. (o) | -97.519 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041511 | Metagenome / Metatranscriptome | 160 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120192_100065092 | F041511 | AGGAG | MALVQKPINGTEYYTDDNVYYTFHQVKVAKDTLWSFACVDLGITKKTGFTSQETKNITDLAGIGQLHPTKFLLLRNGNAIPVPYLANGSSDLRPNDIILRSAVAPDVAKPIIPPVTTVVPPSVSTKSVADRLKEIEDLHDRKLLTDPEYQDKRAKIIAEL* |
| ⦗Top⦘ |