NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119867_1039203

Scaffold Ga0119867_1039203


Overview

Basic Information
Taxon OID3300012018 Open in IMG/M
Scaffold IDGa0119867_1039203 Open in IMG/M
Source Dataset NameActivated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterTongji University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1349
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Shanghai, China

Source Dataset Sampling Location
Location NameChina: Quyang, Shanghai
CoordinatesLat. (o)31.3Long. (o)121.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055725Metagenome / Metatranscriptome138Y
F058997Metagenome / Metatranscriptome134N

Sequences

Protein IDFamilyRBSSequence
Ga0119867_10392031F058997GAGGMIIYKGREMTVREACTLMGIDCDDFMAWCRKFALQNYGYTLNYYKRTLKHG
Ga0119867_10392032F055725AGAAGGMAFFNGEGIDLPTITKLAEAGVSLNSMSKLTGHSRTGIKRALERNKIPFINHVRERFIIVDGVEISLGDACAAKGFSRESLYAWRVKHGLNEQEGFEAYIVYQQSKRTIDKPILTFKNATVIYKKERYTLDAISDKLKLNKQRFEVFMRQNRYAQNAFERYCYMRGL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.