NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120387_1076315

Scaffold Ga0120387_1076315


Overview

Basic Information
Taxon OID3300012016 Open in IMG/M
Scaffold IDGa0120387_1076315 Open in IMG/M
Source Dataset NameSheep rumen microbial communities from Wyoming, USA - O_aries_Forg_1397
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Missouri
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1181
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Ruminant Gut Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)41.314168Long. (o)-105.584589Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037488Metagenome / Metatranscriptome168N

Sequences

Protein IDFamilyRBSSequence
Ga0120387_10763152F037488GAGVNKINNSDSFLKAIASFINEVSSDKKKLYKIYLQFTTEESVQNIIKVLKMVKEPKSFFYYLNLNQPENVKIDFLKYKELFDYIEKVDDVQFFNEWVPKIIEQQIEVSRLYYVNLDEIATDKVIDYSTKYPNKIRELYSFDNKDYDKIKKVCDLNAESLIRIPNCKLDLYTNLKNVEIVTINSEPLPNPLPKDFNYASVKNLETIFIEDDSEEKTNFVIDLINRCTNVETVTFASFAELSKDQFFNIFTKITSKKIKEIGVTCQGFEQDIDYTPIFKNLPKLLKFGVELHSSMDFLFALHPIVSCELVAPSYPCLEQLITNYIKEDDDNYLKGDFPNDFEPFYEYFKN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.