| Basic Information | |
|---|---|
| Taxon OID | 3300012015 Open in IMG/M |
| Scaffold ID | Ga0120187_1069809 Open in IMG/M |
| Source Dataset Name | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Georgia Institute of Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 509 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial → Terrestrial Microbial Communites From A Soil Warming Plot In Okalahoma, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Kessler Farm Field Laboratory (KFFL), Okalahoma | |||||||
| Coordinates | Lat. (o) | 34.975667 | Long. (o) | -97.519 | Alt. (m) | Depth (m) | 500 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F070546 | Metagenome | 123 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120187_10698091 | F070546 | GGAGG | MYFRRLHLALGILLLIALPLSAQAQKTAEAFTEWETISPEGEEFTVSMPKNPTSESTTFPYHKMELNARLYLAKSPAG |
| ⦗Top⦘ |