Scaffold Ga0153805_1000839

Overview

Basic Information

• Taxon OID: 3300012013
• Scaffold ID: Ga0153805_1000839
• Source Dataset Name: Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6353
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location

• Location Name: Ontario, Canada
• Coordinates
  • Lat. (^o): 42.844722
  • Long. (^o): -79.573889

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095457	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153805_10008391	F095457	N/A	RYRHGDVSWLPSLAKQAGWPDHTIDKLTQIVLRESGGCPNRRGGDMVDKDCNITGVSEWNHRSDTGLLQINGVNYDLSRNKWAAVCRQMNICTQEPLLDPLTNLKAGLVLYNLSGFEPWNPCNWRVCKASTTTTAP*