Scaffold Ga0153773_1085606

Overview

Basic Information

• Taxon OID: 3300012009
• Scaffold ID: Ga0153773_1085606
• Source Dataset Name: Saline lake microbial mat microbial communities from La Brava Lake, II Region de Antofagasta, Chile - La Brava 201312
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: INDEAR Instituto de Agrobiotecnologia Rosario
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2155
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Saline Lake Microbial Mat → Saline Lake Microbial Mat Microbial Communities From La Brava Lake, Ii Region De Antofagasta, Chile

Source Dataset Sampling Location

• Location Name: II Region de Antofagasta, Chile
• Coordinates
  • Lat. (^o): -23.730056
  • Long. (^o): -68.246861

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011196	Metagenome / Metatranscriptome	294	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153773_10856062	F011196	GGA	MEVREMGHDATVRAADGYVAQKKAEFLAHAEQAFDRMFGADGQNGLVTFQEREDRACEVGDGLTRWLMAEHLALDPVGGTSIERDCPICGGPVRDESAGQAEMELREFQTLRGKIEYRRAAARCPRCRKIFFPA*