Scaffold Ga0153774_1009893

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0153774_1009893

Scaffold Ga0153774_1009893

Overview

Basic Information
Taxon OID	3300012002 Open in IMG/M
Scaffold ID	Ga0153774_1009893 Open in IMG/M
Source Dataset Name	Saline lake microbial mat microbial communities from Tebenquiche Lake, II Region de Antofagasta, Chile - Tebenquiche 201212
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	INDEAR Instituto de Agrobiotecnologia Rosario
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9147
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Saline Lake Microbial Mat → Saline Lake Microbial Mat Microbial Communities From Tebenquiche Lake, Ii Region De Antofagasta, Chile

Source Dataset Sampling Location
Location Name	II Region de Antofagasta, Chile
Coordinates	Lat. (^o)	-23.138472	Long. (^o)	-68.247194	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070873	Metagenome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153774_10098937	F070873	AGGA	MVWGGSLNKKGSDYLRKLRKADKIVEFLEEFKNDLKEAEKQIVSNTINIIVDHITKLSERRSKRD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.