Scaffold Ga0120167_1050068

Overview

Basic Information

• Taxon OID: 3300012001
• Scaffold ID: Ga0120167_1050068
• Source Dataset Name: Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Tennessee
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 921
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: Canada: Axel Heiberg Island, Nunavut
• Coordinates
  • Depth (m): .8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024215	Metagenome / Metatranscriptome	207	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120167_10500683	F024215	N/A	MELFRWRRWWSRDGLPALRVMAVEHWDPQNVYDDATRADAYDPYLERVGRMLRRGKGPDEIARYLGLVRTKAMRLDESETTDELFADRVSAWYAVEKP*