Scaffold Ga0119951_1004018

Overview

Basic Information

• Taxon OID: 3300012000
• Scaffold ID: Ga0119951_1004018
• Source Dataset Name: Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7389
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (69.23%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 34.21
  • Long. (^o): -83.96

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009065	Metagenome / Metatranscriptome	323	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119951_10040188	F009065	GAGG	MMSFFKNKKPWVKPFSEKVARRVSKIPTGDLEMWAEQALIDISRCLSSYSKNRDTLFLDEALQGSEALHAVVNELHSRMKSR*