Scaffold Ga0119951_1001327

Overview

Basic Information

• Taxon OID: 3300012000
• Scaffold ID: Ga0119951_1001327
• Source Dataset Name: Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 14787
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (9.09%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Algavirales → Phycodnaviridae → Prymnesiovirus → unclassified Prymnesiovirus → Phaeocystis globosa virus 12T (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 34.21
  • Long. (^o): -83.96

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022816	Metagenome / Metatranscriptome	212	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119951_10013274	F022816	N/A	MEAIQQLFAPLDKDYCLLFYWLTVVNFIFLAVASLGFLSSLVLLFRGKISFMSGMYSFLMILVYGLMYFQSRLFYSMCVTSNMKAGTFGMGSPSDSLPAVAKQASGVAPGAYRM*