| Basic Information | |
|---|---|
| Taxon OID | 3300011984 Open in IMG/M |
| Scaffold ID | Ga0119931_1001111 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Hong Kong |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3057 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant → Freshwater Microbial Communities From Drinking Water Treatment Plant - The University Of Hong Kong |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017468 | Metagenome / Metatranscriptome | 240 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119931_10011116 | F017468 | N/A | MKHWEHHPEPVEGCFGCKGLSLQMNAGDADSRRSMPTKAFNKELDAYKEARAQGIQPAGTSMKKIQEAVKASDILGKPYDSSKMAPTKHITKKSAEVLNQLGA* |
| ⦗Top⦘ |