Scaffold Ga0119773_1073299

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119773_1073299

Scaffold Ga0119773_1073299

Overview

Basic Information
Taxon OID	3300011982 Open in IMG/M
Scaffold ID	Ga0119773_1073299 Open in IMG/M
Source Dataset Name	Human oral microbial communities from Beijing, China - VLP3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Institute of Life Science, Chinese Academy of Sciences
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	560
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral → Human Oral Microbial Communities From Beijing, China

Source Dataset Sampling Location
Location Name	Beijing, China
Coordinates	Lat. (^o)	39.9	Long. (^o)	116.3	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103434	Metagenome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0119773_10732991	F103434	GGAG	VVEVTLAVVKEGRTGRRFERGETFVVDKVLVQPSAGNALKATENRAIRGDLTDETTLKVFGTGRKWPGGPHSWVKIIKGPESLVGKTFQQAGEPLTYDASPMTRHWSVRCDTLGTESR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.