Basic Information | |
---|---|
Taxon OID | 3300011982 Open in IMG/M |
Scaffold ID | Ga0119773_1048555 Open in IMG/M |
Source Dataset Name | Human oral microbial communities from Beijing, China - VLP3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Institute of Life Science, Chinese Academy of Sciences |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 767 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral → Human Oral Microbial Communities From Beijing, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Beijing, China | |||||||
Coordinates | Lat. (o) | 39.9 | Long. (o) | 116.3 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051213 | Metagenome | 144 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119773_10485551 | F051213 | N/A | EGKVNKFFDSQAQRKSFRVLTASGKPYNHKIDWHIIGILDPKSETYLTKKVDTLSNGDLKISYDWVAFIVRENKSVIDVEVQKNETGKVRAVYLNTSTSGRQITLPDMRVTQRAK* |
⦗Top⦘ |