Scaffold Ga0119773_1044059

Overview

Basic Information

• Taxon OID: 3300011982
• Scaffold ID: Ga0119773_1044059
• Source Dataset Name: Human oral microbial communities from Beijing, China - VLP3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Institute of Life Science, Chinese Academy of Sciences
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 827
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral → Human Oral Microbial Communities From Beijing, China

Source Dataset Sampling Location

• Location Name: Beijing, China
• Coordinates
  • Lat. (^o): 39.9
  • Long. (^o): 116.3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033081	Metagenome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119773_10440591	F033081	AGG	MAWLFRRAMPQDTRPTFVWSRLVAEIENAGYFSRWKFSILAVGLIIMTIATIKMLLFVPGLNQSAVSLLTRGLETFLPTRWATATAWTVGMAGVFLMGDLTNYTPSQKILHKIKATRYEVYNIILFLALLEEQAFRSGSEKWNWRERVRASVCFGLLHIANIWYSFAAGIALSATGFGFLLVYLWYYRKYRIQIIATAAAATVHALYNAIALSLIAVVLAIDIAKLL*