NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119773_1033405

Scaffold Ga0119773_1033405


Overview

Basic Information
Taxon OID3300011982 Open in IMG/M
Scaffold IDGa0119773_1033405 Open in IMG/M
Source Dataset NameHuman oral microbial communities from Beijing, China - VLP3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Institute of Life Science, Chinese Academy of Sciences
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1017
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral → Human Oral Microbial Communities From Beijing, China

Source Dataset Sampling Location
Location NameBeijing, China
CoordinatesLat. (o)39.9Long. (o)116.3Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054109Metagenome140N

Sequences

Protein IDFamilyRBSSequence
Ga0119773_10334051F054109AGGAGGMVGRPKSKKGAKVHTAFKIYPADKERAQVMAEKLDMSLSSYINKAVLEKVARDEKSEN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.