Scaffold Ga0119773_1010413

Overview

Basic Information

• Taxon OID: 3300011982
• Scaffold ID: Ga0119773_1010413
• Source Dataset Name: Human oral microbial communities from Beijing, China - VLP3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Institute of Life Science, Chinese Academy of Sciences
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2388
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral → Human Oral Microbial Communities From Beijing, China

Source Dataset Sampling Location

• Location Name: Beijing, China
• Coordinates
  • Lat. (^o): 39.9
  • Long. (^o): 116.3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047508	Metagenome	149	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0119773_10104132	F047508	GGAG	MLGHRLVEGRVKYPYLRCIGEYLRHSFDTEDVGWVVKRSKLCALMEHIYYLWGDTYALSKALCTVYEAVTDGVDLIEGLYEVLFFENVEDNLYAACVVRNVKVALNLLSFGVTEGDEGVVDPYALFVPRGQDLVVGELDEGELQGGAATVEDQDFHKVLYYMVRCELIPSSP*