| Basic Information | |
|---|---|
| Taxon OID | 3300011982 Open in IMG/M |
| Scaffold ID | Ga0119773_1000004 Open in IMG/M |
| Source Dataset Name | Human oral microbial communities from Beijing, China - VLP3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Institute of Life Science, Chinese Academy of Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 58284 |
| Total Scaffold Genes | 76 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 69 (90.79%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral → Human Oral Microbial Communities From Beijing, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Beijing, China | |||||||
| Coordinates | Lat. (o) | 39.9 | Long. (o) | 116.3 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F081510 | Metagenome | 114 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119773_100000457 | F081510 | AGGAG | MKLPKIDMKAIKAATKTTYNTAKILGKKYAPVVLVTTGLVGYGVAVYQGIKSGKKLEATKAKYKAKDAAGEEYTRMEVIKDVTKDVAVPVAIAVASTAAIGLGFAIQTNRLKAVSAALTAVTEEHARYRLQCKEVLDEETFKKIDTPMDQVTIEEDGKEAQSFVPKEGLMYGNWFKYSANYASDSPEYNEQWIRESIRVLEEKIARKGVLNFSDMLDQLGFDVPKAALPFGWTDTDGFYIEYDIMEVWNAEEQMHEPQIYVRWKCPRNLYATTNFRDLIPGRKEIA* |
| ⦗Top⦘ |