Scaffold Ga0119798_1004001

Overview

Basic Information

• Taxon OID: 3300011976
• Scaffold ID: Ga0119798_1004001
• Source Dataset Name: Human subgingival plaque microbial communities from Los Angeles, CA, USA - S13-02-D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of California, Los Angeles
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6165
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (69.23%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Subgingival Plaque → Human Oral Microbial Communities From Los Angeles, Ca, Usa

Source Dataset Sampling Location

• Location Name: USA: Los Angeles
• Coordinates
  • Lat. (^o): 34.0722
  • Long. (^o): -118.4441

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084362	Metagenome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0119798_10040016	F084362	N/A	MNCTFTVRWSDDKNKPHAKTYATEADAKRAKKWLLEHGVRSIDIAVKINNKPAGSLQDSEKRPEVAAEQKGFWWEK*