NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119808_106529

Scaffold Ga0119808_106529


Overview

Basic Information
Taxon OID3300011928 Open in IMG/M
Scaffold IDGa0119808_106529 Open in IMG/M
Source Dataset NameHuman oral microbial communities from Los Angeles, CA, USA - S17-04-R
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, Los Angeles
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1945
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Capnocytophaga(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: Los Angeles
CoordinatesLat. (o)34.0722Long. (o)-118.4441Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064818Metagenome128N

Sequences

Protein IDFamilyRBSSequence
Ga0119808_1065291F064818N/AMDKDEFLKKLIAFIADNSSELHPKVFKNKIRFGINKSFYTEMQFDYSQNYKGFYLQLASYNREVGDFFEQEMGNAFLKMLEDESKEFRNLFFVQNSFQLSHYYYGFPIMTNDNTGHLYPEMGTTIFNDVLRNLQANHFKFIQAAEVLSPDLLHYIKKFPSCFFNTALVALLIIERNLLSLDDERVQGLFEYDNMVTKNECKLFSPFDLIFGKKDYQQTAKQRILQRK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.