Scaffold Ga0120089_112591

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0120089_112591

Scaffold Ga0120089_112591

Overview

Basic Information
Taxon OID	3300011921 Open in IMG/M
Scaffold ID	Ga0120089_112591 Open in IMG/M
Source Dataset Name	Mine pit pond microbial communities from Vermont, USA - 2M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Vermont
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	697
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Geologic → Mine → Unclassified → Mine Pit Pond → Mine Pit Pond Microbial Communities From Vermont, Usa

Source Dataset Sampling Location
Location Name	USA: Vermont
Coordinates	Lat. (^o)	43.727094	Long. (^o)	-72.425964	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013252	Metagenome	273	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120089_1125911	F013252	AGGAG	MADNNLKGFRQTYQETGNISSGGGPGDKKLDKGASGSKRASNAVKGKPARSSKVGPDKNLKDVKTGNFY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.