NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120089_101170

Scaffold Ga0120089_101170


Overview

Basic Information
Taxon OID3300011921 Open in IMG/M
Scaffold IDGa0120089_101170 Open in IMG/M
Source Dataset NameMine pit pond microbial communities from Vermont, USA - 2M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Vermont
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4306
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (10.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Geologic → Mine → Unclassified → Mine Pit Pond → Mine Pit Pond Microbial Communities From Vermont, Usa

Source Dataset Sampling Location
Location NameUSA: Vermont
CoordinatesLat. (o)43.727094Long. (o)-72.425964Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013634Metagenome / Metatranscriptome269Y
F025485Metagenome / Metatranscriptome201Y
F031456Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0120089_1011705F031456N/AMAFIGNFPASGSAVFNLDFLPEYVLVDSANQATQSLSNFSVVTSGVQLMSITNVNRLTALAKFDSGAILDDFVGTELSRTSSYIKLATGRINKTTTITGTNGVALARAFYAASTNISNVARRAVEQSINPSANATFDNFEALFFDETNILRAQITFANGFTDEFTTVELRALYSTYHVSDESSLLSGLVCIDADSGAGLISQVVLFNGAGGSTVVLKSDYVQL*
Ga0120089_1011706F013634N/AMSNCNKNQNMAIQLAPLVGAGLGALQQSKIEKALAGEKTYTKPKTIFGKLIGGVSGRTAAAEASAQTKTAPLNEKVMNSLQPSAKSTPVSGGISFGGEASRKTYLPFAIVAAVIAAFYFMRKKGGRRRR*
Ga0120089_1011708F025485AGAAGMENVRKFLPLIIGGIVAIAFFFISRKVRQGSGNSQERSEILEKAREAKLAKSILKKSENEESTSNIES*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.