NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120089_100921

Scaffold Ga0120089_100921


Overview

Basic Information
Taxon OID3300011921 Open in IMG/M
Scaffold IDGa0120089_100921 Open in IMG/M
Source Dataset NameMine pit pond microbial communities from Vermont, USA - 2M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Vermont
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5358
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (95.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Geologic → Mine → Unclassified → Mine Pit Pond → Mine Pit Pond Microbial Communities From Vermont, Usa

Source Dataset Sampling Location
Location NameUSA: Vermont
CoordinatesLat. (o)43.727094Long. (o)-72.425964Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068601Metagenome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0120089_10092117F068601GGAGGVRTNESLENIVELSDIREGRLRALSPYGPVKAGLTTLPTTNEVRLMELLNSLENVVHDLNYKSFTAYDTLNTAIQGVRAALSVTLIEEGGTDAELDPE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.