Scaffold Ga0120089_100921

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0120089_100921

Scaffold Ga0120089_100921

Overview

Basic Information
Taxon OID	3300011921 Open in IMG/M
Scaffold ID	Ga0120089_100921 Open in IMG/M
Source Dataset Name	Mine pit pond microbial communities from Vermont, USA - 2M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Vermont
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5358
Total Scaffold Genes	20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	19 (95.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Geologic → Mine → Unclassified → Mine Pit Pond → Mine Pit Pond Microbial Communities From Vermont, Usa

Source Dataset Sampling Location
Location Name	USA: Vermont
Coordinates	Lat. (^o)	43.727094	Long. (^o)	-72.425964	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068601	Metagenome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120089_10092117	F068601	GGAGG	VRTNESLENIVELSDIREGRLRALSPYGPVKAGLTTLPTTNEVRLMELLNSLENVVHDLNYKSFTAYDTLNTAIQGVRAALSVTLIEEGGTDAELDPE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.