Scaffold Ga0121021_100047

Overview

Basic Information

• Taxon OID: 3300011871
• Scaffold ID: Ga0121021_100047
• Source Dataset Name: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00705
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Weill Cornell Medical College
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 111190
• Total Scaffold Genes: 157
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 116 (73.89%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Source Dataset Sampling Location

• Location Name: USA:New York City
• Coordinates
  • Lat. (^o): 40.86
  • Long. (^o): -73.91

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009686	Metagenome / Metatranscriptome	314	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0121021_10004729	F009686	AGGAG	MSEREMFEQSFKRPSNYFKLTSREQWNIDAELGILDWQGDDLSNEDMKRFNEHYN*