Basic Information | |
---|---|
Taxon OID | 3300011435 Open in IMG/M |
Scaffold ID | Ga0137426_1034719 Open in IMG/M |
Source Dataset Name | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1278 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: East River, Colorado | |||||||
Coordinates | Lat. (o) | 38.8893 | Long. (o) | -106.9078 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051241 | Metagenome / Metatranscriptome | 144 | Y |
F101460 | Metagenome | 102 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137426_10347192 | F101460 | N/A | MEAALKRAVILPLTAIASAASAVEALPPSGELGCDDAGLETCEFFDPASGLRVRLPQDWPMRRLRVSTETGPSAGVRQRFAERWVVIDYVPEEPANPEASLFYAAVIPRAAWLRLSSGPEPAPGTEVASSPSLTVIAAQGSTNPYPPDSRDAQIYEALIPSLEEISLILTLRPAR* |
Ga0137426_10347193 | F051241 | GGAG | MLEEEAEKRGKTPPPPPLTHGLEHDPTEEEKIERLREQLIWADRNTLLHQIQMFFEAMPPSAWEKLSTRK* |
⦗Top⦘ |