NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0151147_1313349

Scaffold Ga0151147_1313349


Overview

Basic Information
Taxon OID3300011426 Open in IMG/M
Scaffold IDGa0151147_1313349 Open in IMG/M
Source Dataset NameFecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E36 Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)735
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Source Dataset Sampling Location
Location NameUSA: Point Reyes National Seashore, California
CoordinatesLat. (o)38.04Long. (o)-122.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005470Metagenome / Metatranscriptome399Y

Sequences

Protein IDFamilyRBSSequence
Ga0151147_13133491F005470N/AMSSIKLRKEGQLITEFPADMVPRSRLLTKLVEEFNSTEVDLEPAPGKDFSPATINKVKEFLQKFDKGLSKMPKKPLLIFVTYNDWLDNNFEEKLREWLEEFLKPKSFYDLVELFNAAFYLQIDDLREICAARIAHSIILERKAPEDFLRDFGIVTQYQDFFTPEEEAKFIEKEFINKNDFEGVAAEEEDELNKE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.