| Basic Information | |
|---|---|
| Taxon OID | 3300011401 Open in IMG/M |
| Scaffold ID | Ga0153984_1047424 Open in IMG/M |
| Source Dataset Name | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA068 MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 920 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia, Alexander Wildlife Management Area | |||||||
| Coordinates | Lat. (o) | 33.0108 | Long. (o) | -81.8997 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029214 | Metagenome / Metatranscriptome | 189 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0153984_10474242 | F029214 | AGGA | MTNSTTTSMHSTNQGYAAVNRKSSDTAPMVITRLAGWIDVSELKTETRAWIVPTRVHQAAR* |
| ⦗Top⦘ |