Scaffold Ga0153970_1003132

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0153970_1003132

Scaffold Ga0153970_1003132

Overview

Basic Information
Taxon OID	3300011394 Open in IMG/M
Scaffold ID	Ga0153970_1003132 Open in IMG/M
Source Dataset Name	Attine ant fungus gardens microbial communities from Georgia, USA - TSGA054 MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3667
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (20.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location Name	USA: Georgia, George L Smith State Park
Coordinates	Lat. (^o)	32.5455	Long. (^o)	-82.1221	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015172	Metagenome	256	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153970_10031321	F015172	GGAG	MSGRDVLSNGRKKTPLTRQERWGGERLIERPWLQLICCAPVSGCEVGRVFQSEGSHQDRGPKESSEGARVDKMRLGPDDVNLQTEELYGNYSVLIVSAE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.