Scaffold Ga0154002_1005988

Overview

Basic Information

• Taxon OID: 3300011393
• Scaffold ID: Ga0154002_1005988
• Source Dataset Name: Attine ant fungus gardens microbial communities from New York, USA - TSNY086 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3257
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: New York, Robert Cushman Murphy County Park
• Coordinates
  • Lat. (^o): 40.8926
  • Long. (^o): -72.8224

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027070	Metagenome	195	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0154002_10059885	F027070	N/A	MKNLGLCHRVEGRIYTEKGKGVLTVQEGKGGDASVCKRPAKERIYLTVQVTPNVTSILCNKEEWHMENGTELSTHKSVDNKEWVLLTSHCGYTRWSRKEKGVYKAGPEVGIQ*