NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0151652_11768042

Scaffold Ga0151652_11768042


Overview

Basic Information
Taxon OID3300011340 Open in IMG/M
Scaffold IDGa0151652_11768042 Open in IMG/M
Source Dataset NameCombined Assembly of Wetland Metatranscriptomes
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)507
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location
Location NameTwitchell Island, Sacramento and San Joaquin Delta, California, USA
CoordinatesLat. (o)38.107Long. (o)-121.6475Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022634Metagenome / Metatranscriptome213Y

Sequences

Protein IDFamilyRBSSequence
Ga0151652_117680421F022634N/AKVLDIPRSGKRGNMVWQSNRYGQYSYPAFIPFNPRTAAQVAVRGTFGAVSARWRTLTEEQRVIWCAVARTKRSKPRLQQCGPLTGFLYFVKINVALANRGLAQVDLPPEYSQASQRIVASLLYTGKFDQPPVGPALFLRANKLIAGWDNVLRQLVARALPPGG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.