Scaffold Ga0151652_11034663

Overview

Basic Information

• Taxon OID: 3300011340
• Scaffold ID: Ga0151652_11034663
• Source Dataset Name: Combined Assembly of Wetland Metatranscriptomes
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3342
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium JGI_Cruoil_03_51_56 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location

• Location Name: Twitchell Island, Sacramento and San Joaquin Delta, California, USA
• Coordinates
  • Lat. (^o): 38.107
  • Long. (^o): -121.6475
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093176	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0151652_110346632	F093176	GAGG	MLLVFVLCVLAVAYLYQHSYSVKLTRNLSRLETQRQLLAEQLDGVDAEIVRLSAFARMESLWVAQGQPAAPGDQMVIAQGQVVAMARQPGADAAAH*