NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153700_10146

Scaffold Ga0153700_10146


Overview

Basic Information
Taxon OID3300011339 Open in IMG/M
Scaffold IDGa0153700_10146 Open in IMG/M
Source Dataset NameLotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)34878
Total Scaffold Genes47 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)38 (80.85%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location NameSeoul, South Korea
CoordinatesLat. (o)37.5254611Long. (o)127.0168945Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049633Metagenome / Metatranscriptome146Y
F051131Metagenome / Metatranscriptome144N
F052593Metagenome / Metatranscriptome142Y
F073556Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0153700_1014637F073556AGGAGMIFDDKTEDEIFRSIEGEVAKALSEIRCAKKDLEQAEVRMKFALATIHYLKQRYEDMK*
Ga0153700_1014638F052593AGGMAFIFPAPGVENVEMTLAIRVTGDTSGLLVPAIQDITVNAATDVFTWTQLDEESKLQIPTTATNSLDLNLVLDQVKFFGTGTGTDVAIKEGIFGLSQNKRAVDFTLYMGDTSTGGAGKTLTGVAYITGLAPTVSADAPVWVSPVTLTVTGNYTVA*
Ga0153700_1014639F049633GAGMRTELLTYLTAQLTESIKTSQELPFQEGTNPLYMKNARRVYLDEPYTEEDTLLPTLGSLQINQRVTIVRWFLTVDAKNRNQDLDSALTILGSAKDITTITGVYTRLFDYTVSIDNDRVVYEGEYRFANLA*
Ga0153700_1014640F051131AGGAMNRAFIYSYKTFVSFATYEDVTNRDSRVFEANEDLTESEINDYLEQASQRILTQIRNTEWWREYQRRMAQITNPNLLPAVNPDYILARTQEFKDLNVYFALMEYVYPTVADFGNPDSAEFAKIKFYKDSYNVLFDEVIEAGDWYDFSENGTIDTSDKMATFVNRVRVR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.