Basic Information | |
---|---|
Taxon OID | 3300011338 Open in IMG/M |
Scaffold ID | Ga0153699_1664 Open in IMG/M |
Source Dataset Name | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Haengju |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chunlab, Inc |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 13108 |
Total Scaffold Genes | 11 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (81.82%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Seoul, South Korea | |||||||
Coordinates | Lat. (o) | 37.5955556 | Long. (o) | 126.817072 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082391 | Metagenome / Metatranscriptome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0153699_16648 | F082391 | GGAGG | VDNNNKVPRSVHFADFLVVLAGFVHNVASSVQTATEELMEIAVYNANRNSEVNKVWEQFSNDLEKIQEDTDGR* |
⦗Top⦘ |