NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153699_1638

Scaffold Ga0153699_1638


Overview

Basic Information
Taxon OID3300011338 Open in IMG/M
Scaffold IDGa0153699_1638 Open in IMG/M
Source Dataset NameLotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Haengju
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)13470
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (77.78%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location NameSeoul, South Korea
CoordinatesLat. (o)37.5955556Long. (o)126.817072Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008490Metagenome / Metatranscriptome332Y
F082391Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0153699_163816F082391GGAGGVDDKDIKVPRSVHFADFLVVLAGLVHNISSSIHTATEELMEIAVYNANRNSEVNKVWEQFSNDLEKIQEDTDGR*
Ga0153699_16386F008490AGGAGMYNSENGKMDDMGMEEDLMPYPASDKQYPGAAKYSSYESIQTGAMGKAAK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.