Scaffold Ga0153702_1516

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0153702_1516

Scaffold Ga0153702_1516

Overview

Basic Information
Taxon OID	3300011337 Open in IMG/M
Scaffold ID	Ga0153702_1516 Open in IMG/M
Source Dataset Name	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chunlab, Inc
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	13107
Total Scaffold Genes	25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	20 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location Name	Paju, Gyeonggi-do, South Korea
Coordinates	Lat. (^o)	37.6518694	Long. (^o)	126.72164723	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002130	Metagenome / Metatranscriptome	591	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153702_15167	F002130	N/A	MSEKPESIIDKVLTYVDSPCKLFAILIMGVVAFAGYFLWQNQTFMFDAYKESKKLPEINDARADDASSMLLKKTSATVVAVFKVNPLFNSRVLYKAYTKDGRDKTIEDIDVGLFSQNSANNADVVKLMTNEIPCGDYRYAQSEVGLWYLDKGVTFTCRVSVPPDSHRFVGQVTVGWAEPPTDIQQVKFMLEIASAMLTKRGN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.