Scaffold Ga0153702_1436

Overview

Basic Information

• Taxon OID: 3300011337
• Scaffold ID: Ga0153702_1436
• Source Dataset Name: Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chunlab, Inc
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 14193
• Total Scaffold Genes: 18
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (27.78%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location

• Location Name: Paju, Gyeonggi-do, South Korea
• Coordinates
  • Lat. (^o): 37.6518694
  • Long. (^o): 126.72164723

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082694	Metagenome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153702_143610	F082694	N/A	MGTKSARQILEAAIASHLSAQTELAGVYIYTGDGADTNVLPKAIVLCDSARAPNDLPQGLGNYSCGTRITVFSSADDNTLAEHRARCAAVAGAMQDLAAIQAVFVAGGDALCYDVTPQSEDEGVNERSWASVFSYDILVVVNPQP*