Scaffold Ga0153702_1373

Overview

Basic Information

• Taxon OID: 3300011337
• Scaffold ID: Ga0153702_1373
• Source Dataset Name: Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chunlab, Inc
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 15824
• Total Scaffold Genes: 27
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 24 (88.89%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location

• Location Name: Paju, Gyeonggi-do, South Korea
• Coordinates
  • Lat. (^o): 37.6518694
  • Long. (^o): 126.72164723

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013890	Metagenome	267	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153702_137323	F013890	AGGA	MGFVEYFDETTGVWTNIEDIPLYDTINCQLCNEPTEAHDIVAEIKFKDDQPIVGAWQCRKCHAVNG*