| Basic Information | |
|---|---|
| Taxon OID | 3300011335 Open in IMG/M |
| Scaffold ID | Ga0153698_1747 Open in IMG/M |
| Source Dataset Name | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chunlab, Inc |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 12339 |
| Total Scaffold Genes | 17 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (29.41%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hwacheon, Gangwon-do, South Korea | |||||||
| Coordinates | Lat. (o) | 38.0874861 | Long. (o) | 127.761456 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028807 | Metagenome / Metatranscriptome | 190 | Y |
| F082694 | Metagenome | 113 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0153698_174712 | F082694 | N/A | MGTKSSRQILEAAIASHRSAQTELAGVSIYTGDGADINVLPKAIVLCDSARAPNDMPQGLGNYSCGTRVTVFSSADDNTLAEHRARCAAVAGAMQDLTAIQAVFVAGGDALCYDVTPQSEDEGVNERSWASVFSYDILIVVNPQP* |
| Ga0153698_17473 | F028807 | AGGCGG | MITYKISMLGATLADPYQLLAAVFPQRNGEPAESDGCAVTVTFDTPQTPADLGPLVKVEVIPNP* |
| ⦗Top⦘ |