| Basic Information | |
|---|---|
| Taxon OID | 3300011335 Open in IMG/M |
| Scaffold ID | Ga0153698_1322 Open in IMG/M |
| Source Dataset Name | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chunlab, Inc |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 20679 |
| Total Scaffold Genes | 40 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (17.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hwacheon, Gangwon-do, South Korea | |||||||
| Coordinates | Lat. (o) | 38.0874861 | Long. (o) | 127.761456 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F103237 | Metagenome | 101 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0153698_132213 | F103237 | N/A | MKKLLLSVIVMLFIMTSCKTKSNCDAYTKNLNNGIDSLENKIQSQIDKNKLLEEYIVLLENDNQILGSVLAEKELEDGIK* |
| ⦗Top⦘ |