NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153697_1515

Scaffold Ga0153697_1515


Overview

Basic Information
Taxon OID3300011334 Open in IMG/M
Scaffold IDGa0153697_1515 Open in IMG/M
Source Dataset NameLotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)11302
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (46.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location NameDaesunglee, Gyeonggi-do, South Korea
CoordinatesLat. (o)37.6746111Long. (o)127.3841278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048993Metagenome147N

Sequences

Protein IDFamilyRBSSequence
Ga0153697_151515F048993GAGMNRYLVEISATMIVDSHYDIDDIATGIAARLEEIAQSNAHLLDYEVVPFILPEPLTDESSHQRDRVSQP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.