Scaffold Ga0153697_1377

Overview

Basic Information

• Taxon OID: 3300011334
• Scaffold ID: Ga0153697_1377
• Source Dataset Name: Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chunlab, Inc
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 14111
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (21.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location

• Location Name: Daesunglee, Gyeonggi-do, South Korea
• Coordinates
  • Lat. (^o): 37.6746111
  • Long. (^o): 127.3841278

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014249	Metagenome / Metatranscriptome	264	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153697_13775	F014249	N/A	MAMNNTYFGFPLAILQELQTDFTACLKAIALAGASYSIAGRSFTRANLAEVAQTIKELQAAIDNAGGNRVTRYTPTFPTQRP*