| Basic Information | |
|---|---|
| Taxon OID | 3300011328 Open in IMG/M |
| Scaffold ID | Ga0138388_1207154 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Southern Atlantic ocean - KN S17 250_B metaT (Metagenome Metatranscriptome) (version 2) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 546 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED161 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -28.2362 | Long. (o) | -38.4949 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F067833 | Metagenome / Metatranscriptome | 125 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0138388_12071543 | F067833 | N/A | VLMVVMKLTVLLHHVKTKVYGIVAMANASQHHMYVMAQVNSVTQAGVLTVPMVQMKV* |
| ⦗Top⦘ |