NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0138349_1032711

Scaffold Ga0138349_1032711


Overview

Basic Information
Taxon OID3300011312 Open in IMG/M
Scaffold IDGa0138349_1032711 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Pacific Ocean - MP2100 (Metagenome Metatranscriptome) (version 2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)602
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)14.317Long. (o)-118.4642Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066319Metagenome / Metatranscriptome126N

Sequences

Protein IDFamilyRBSSequence
Ga0138349_10327111F066319N/AGIANAGVDLWDQSTETGSWSNTNASGYYLLVAEPGVYRFNIWPGMGGDMGGFWLNSYNLTSDTVYNVTLTPRAQFTPLQLNPSSARSGETISVSFDITAESGGGALTGVSDNSFKIWLHNWGAEPQGSNWWENPTSTQYHQDLSDDVTVAEGVAGSYSFSFEVPSGMNITGGWMDLEVRMGDSGGWAGLMMASSSAVQLS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.