| Basic Information | |
|---|---|
| Taxon OID | 3300011292 Open in IMG/M |
| Scaffold ID | Ga0138377_166231 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Southern Atlantic ocean - KN S15 250m_A metaT (Metagenome Metatranscriptome) (version 2) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 938 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -28.2362 | Long. (o) | -38.4949 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003733 | Metagenome / Metatranscriptome | 471 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0138377_1662311 | F003733 | AGGA | MKALRTRICTYAIALLASLGFATSTLAGSSDFAGIFIAGHAELNVVAIPGTHTAGGAGSDSSGGTENVETTEGTIGGFAPTAGYEIGFNLPLGDTFFVTVGYADGGGKSAAIAKVDDENGISDISLHASNPNWYYIAPAISIFDNSAVYFKLGRAQADLEAIGDLTGAVSGMEGDMWGIGTTSIAGNGLFLKTEAGAIQYDEFKVTGLGGDSTTTVEGKPFIGYG |
| ⦗Top⦘ |